} "disallowZeroCount" : "false", { The way domain names work is that when you type one into your browser, such as google.com, your browser is directed to a server. "context" : "envParam:entity", "action" : "pulsate" } "}); "action" : "rerender" To earn your Cisco Meraki Solutions Specialist certification, you need to pass one 90-minute exam: 500-220 Engineering Cisco Meraki Solutions . You may choose another option from the dropdown menu. "eventActions" : [ "eventActions" : [ "action" : "rerender" }, } { and our DigitBin doesnt endorse the software tools nor it is affiliated with it in any form. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); This is working across my entire network as expected. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "actions" : [ } "action" : "rerender" ] "}); { "useTruncatedSubject" : "true", { "useSortHeader" : "false", Ive mentioned a few methods that work for bypassing the administrator setting on the network to access blocked sites. Are you sure you want to proceed? } ] "useSubjectIcons" : "true", } }, ] Note: This post is for informational purposes only. Get notified when there are additional replies to this discussion. }, "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "expandMessage", Are you sure you want to proceed? "action" : "rerender" "actions" : [ ] "action" : "rerender" }, "actions" : [ "actions" : [ ] Consider the following: If a client is being blocked from accessing a page, the easiest way to tell whether content filtering is blocking the traffic is to check your event log. If you have a website that you believe is being miscategorized by your security appliance's firewall, you can submit a URL categorization change request here. "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "pulsate" ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Example: LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/security/message-id/2507/thread-id/2507","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bfr7-JKXv8kHUgPH-ed6-ot7ToSZFIx02tf4mtQEBUI. } "selector" : "#kudosButtonV2", "linkDisabled" : "false" }, "initiatorDataMatcher" : "data-lia-kudos-id" { }, If you are having troubles fixing an error, your system may be partially broken. "event" : "kudoEntity", "actions" : [ Reset the Edge. "parameters" : { ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_e2e384343fe895","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", ] The certification prepares you to adequately manage and grow your Meraki deployments as the needs of your network grow, and the confidence to ensure the solution is performing securely and as expected. Heres what you need to do: If your ISP is, indeed, blocking the service/website, the issue is not on your side. { ] }, "}); { { }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", If your browser/the website is using HTTPS/SSL, the browser will not be forwarded to the block page. ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); Are you sure you want to proceed? }, } Please note that HTTPS requests will not result in a block page, refer to the Troubleshooting section for more details. To apply the allow list or block on a per SSID basis or only on the MX Security Appliance, select Different policies by connection and SSID . }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "actions" : [ "event" : "MessagesWidgetEditAction", Click on Control Panel in the search results. You can just verify it and click on "Add this Network" to configure your network with OpenDNS servers. How can Iunblock a site that is being blocked? Content filtering is best used for setting catch-all blocks for certain categories of trafficor for blocking certain URL patterns. } "}); "actions" : [ "includeRepliesModerationState" : "true", "action" : "rerender" "context" : "envParam:quiltName", ] "event" : "expandMessage", "context" : "envParam:quiltName,message", "context" : "", ] Open a web browser. ], }, In the "Details"section, the category will be defined if the traffic was blocked by the content filter. If you are on the latest stablefirmware versionand are still experiencing issues with sites being blocked that should not be, there are a few other factors that could contribute: There are several factors that can contribute to a website not being blocked when it should be. "event" : "addMessageUserEmailSubscription", It's not uncommon to have a problem with software like Avast blocking the internet on Windows 10, or any other antivirus program doing this, due to security measures. { }, "action" : "rerender" Click on the three dots () on thetop right corner. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_e2e384343fe895","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_e2e384343fe895","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"security|forum-board":{"title":"Search Board: Security / SD-WAN","inputSelector":".lia-search-input-message"},"meraki|category":{"title":"Search Community: Security / SD-WAN","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Security / SD-WAN","inputSelector":".lia-search-input-message"},"user|user":{"title":"Users","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_e2e384343fe895_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "context" : "", { { "actions" : [ } As a result, some websites/services might become unavailable region-wide. To ensure that the firewall rules are being applied to the client, the policy on the clients page can be set to "Blocked"to test to make sure the client is actually being blocked. "event" : "MessagesWidgetCommentForm", Go to Advanced, select Security, and enable the WPA3 or WPA2/WPA3 security protocol. Any image, link, or discussion of nudity. } "context" : "", We recommend downloading this PC Repair tool (rated Great on TrustPilot.com) to easily address them. "action" : "pulsate" This can be caused by AMP (threat protection). Use a website like isup.me to check whether the website is down for everyone or just you. "useTruncatedSubject" : "true", Cisco Merakiappliances and access pointscan be configured with Layer 7 firewall rules to block traffic by applicationor destinationhostname. You just need to isolate the issue and take the appropriate course of action depending on the situation. $('.spinner', divContainer).remove(); "initiatorBinding" : true, "action" : "rerender" "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ "actions" : [ { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; If the website remains available after this time, referencethe Troubleshooting the Block Page section of this article. "action" : "addClassName" "message" : "10599", "selector" : "#kudosButtonV2_3", ] "componentId" : "forums.widget.message-view", In instances where another firewall is positioned upstream fromthe MX, the following FQDN destinations need to be allowed in order for categorization information traffic to pass successfully to the MX, so it can use the proper category classifications. 4. Get notified when there are additional replies to this discussion. "event" : "MessagesWidgetEditAnswerForm", ] }, Web search filtering is not filteringsearches, Hosted email applicationsare being blocked, Blocked URL patterns are not being blocked, Whitelisted URL patterns are not being allowed, Configuring Active Directory with MX Security Appliances, www.example.com?url=www.dashboard.meraki.com.